LL-37 Ацетат - Аликвота, 5 мг

3200,00 

  • Кодировка партии и лота с общедоступными лабораторными отчетами для обеспечения качества и прозрачности.
  • Разница в концентрации на партию менее 10 %, что гарантирует постоянство.
  • Не содержит коррозионных агентов для обеспечения безопасности.
  • Стеклянные аликвоты с обжимной крышкой для минимизации деградации.
  • Непроницаемая пломба для обеспечения безопасности при транспортировке.
SKU: Category:
Application Agonist of formyl peptide receptor like-1 (FPRL-1), purinergic receptor P2X7, epidermal growth factor receptor (EGFR) and insulin-like growth factor-1 receptor (IGF-1R)
CAS 154947-66-7
Molar Mass 4493 g/mol
Chemical Formula C205H340N60O53
Amino Acid Sequence [LL-37, 37 aa]
Synonyms CAMP, IPR001894, CAP-18, CAP18, CRAMP, HSD26, gene FALL39, gene LL37, FALL39, LL37, FALL-39, cathelicidin antimicrobial peptide, Cathelicidins, Cathelicidin, LL-37, 154947-66-7, Ropocamptide, Bac4, All38 peptide, Cathelicidin LL 37, LL-37 (Human), hCAP 18, UNII-3DD771JO2H, LL-37 trifluoroacetate salt, LL-37/hCAP18, 3DD771JO2H, CHEMBL530345, LL 37, Cathelicidin antimicrobial peptide 18, AKOS024458536
Storage Store in refrigerator at 4°C, tightly sealed, away from heat, light and moisture
Solubility Soluble in BAC water
Organoleptic Profile Solid, white powder in 3mL glass aliquot
Composition Each aliquot contains LL-37, Acetate (counterion)
Specification LL-37 content for each variant (per aliquot):
LL-37 6mg ±10%
Terms This material is sold for laboratory research use only. Terms of sale apply. Not for human consumption, nor medical, veterinary, or household uses. Please familiarize yourself with our Terms & Conditions prior to ordering.

Reviews

There are no reviews yet.